| Transcript | Ll_transcript_230633 |
|---|---|
| CDS coordinates | 233-562 (+) |
| Peptide sequence | MLSFRKVSFFTDKKEFQRSATALGYVAHAVSLIASYLQVPLRYPLRLGGSHSYIIDNAPSIESTSSDASSSALSFTNGKHIEFPLFLEGQDTTRAAYAVFLLNKVCHFI* |
| ORF Type | complete |
| Blastp | UV radiation resistance-associated gene protein from Homo with 43.53% of identity |
|---|---|
| Blastx | UV radiation resistance-associated gene protein from Homo with 42.35% of identity |
| Eggnog | UV radiation resistance(ENOG410YZ0H) |
| Kegg | Link to kegg annotations (7405) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019464645.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer