Protein coding transcript 150726

• Transcript: Ll_transcript_230570
• CDS coordinates: 302-763 (+)
• Peptide sequence: MGSALETLCGQAYGAGQIRMLGVYMQRSWVILLVTALFMIPIYVWSPPILRLIGQTPEISDVAGKFSLWMLPQLFAYSLNFPIQKFLQAQRKVNVMLWISAAVLVFHTFFSWLLILKLGWGIKGAAVTLNISWWLVVIAQSLYIFITKSEGAWS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_230570

• Blastp: Protein DETOXIFICATION 33 from Arabidopsis with 72.08% of identity
• Blastx: Protein DETOXIFICATION 33 from Arabidopsis with 72.44% of identity
• Eggnog: Mate efflux family protein(COG0534)
• Kegg: Link to kegg annotations (AT1G47530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458382.1)
• Pfam: MatE (PF01554.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;