Protein coding transcript 1508

• Transcript: Ll_transcript_425654
• CDS coordinates: 150-1238 (+)
• Peptide sequence: MASSSVLFTDTSPSSAARLLHLRHRHAVVPFVRPLRVGPTQFPTPLRFSLHTSPSRPPLVPLASLTTEASAKVIDGKSVAKQIRVEVTAEVSRMKEAIGVTPGLAVILVGDRKDSATYVRNKKKACDSVGIISLEANLPEDSTEQEVLNYISSFNDDPSVHGILVQLPLPKHMNEQNILNAVRIEKDVDGFHPLNIGRLAMRGREPLFVPCTPKGCIELLHRYGVPIKGKRAVVIGRSNIVGMPAALLLQREDATVSIVHSRTNNPEEITRQADIIISAVGQPNMIRGNWIKPGAVIIDVGINPVEDSNDPRGYRLVGDVCYEEASKVASAVTPVPGGVGPMTIAMLLQNTLISAKRIHNFE*
• ORF Type: complete

Annotations of Ll_transcript_425654

• Blastp: Bifunctional protein FolD 4, chloroplastic from Arabidopsis with 75.07% of identity
• Blastx: Bifunctional protein FolD 4, chloroplastic from Arabidopsis with 84.67% of identity
• Eggnog: Catalyzes the oxidation of 5,10- methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10- formyltetrahydrofolate (By similarity)(COG0190)
• Kegg: Link to kegg annotations (AT4G00620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426409.1)
• Pfam: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;