Protein coding transcript 150867

• Transcript: Ll_transcript_88389
• CDS coordinates: 428-817 (+)
• Peptide sequence: MNMTPRSSYGGSSSGGGGGGGGRTRVGKYELGRTMGEGNFAKVKFARDSGTGEAVAIKVLDKQILLRHKMMGQIKREISTMKLIRHPNIIRMYEVMASKTKIYIVMELLTGGELFDKIVRQFYHRKILE*
• ORF Type: complete

Annotations of Ll_transcript_88389

• Blastp: CBL-interacting protein kinase 23 from Oryza sativa with 80% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 9 from Arabidopsis with 76.69% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020970920.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;