Protein coding transcript 15090

• Transcript: Ll_transcript_426656
• CDS coordinates: 668-1297 (+)
• Peptide sequence: MDRSLPAPPTAVFLHGILGCRKNWGTFARRLAQGFPTWQFLLVDMRCHGDSASIKKRGPHTVQSAALDVLKLVRELRITPRVLVGHSFGGKVALSMVDQAAKPLARPVKVWSLDATPGKVRAGGDGEDHPAELISFLRTLPKEVSSKRDVVKALIHQGFSNDVAQWVVTNLRSTSSTDSKLSSFTWVFDLMGIAEMYRSYEGTNLWYLL*
• ORF Type: complete

Annotations of Ll_transcript_426656

• Blastp: Protein ABHD11 from Silurana with 30.05% of identity
• Blastx: Protein ABHD11 from Xenopus with 30.05% of identity
• Eggnog: Alpha beta hydrolase(COG0596)
• Kegg: Link to kegg annotations (779475)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444614.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;