Transcript | Ll_transcript_426657 |
---|---|
CDS coordinates | 132-803 (+) |
Peptide sequence | MSLISNCSPSYATVAGAGAGAAASNRRPKFPSNSWINTNAISQNDKFNVSRLALSHSNHRVKDRTISMALVGGALGQKGDVSTSSSTLAYDLIQGALVRWSSDMDRSLPAPPTAVFLHGILGCRKNWGTFARRLAQGFPTWQFLLVDMRCHGDSASIKKRGPHTVQSAALDVLKLVRELRITPRVLVGHSFGGKVALSMVDQAAKPLARPVKVGPNLMTVCLC* |
ORF Type | complete |
Blastp | Putative esterase/lipase HI_0193 from Haemophilus with 26.87% of identity |
---|---|
Blastx | Protein ABHD11 from Silurana with 34.29% of identity |
Eggnog | Alpha beta hydrolase(COG0596) |
Kegg | Link to kegg annotations (HI0193) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444614.1) |
Pfam | Serine aminopeptidase, S33 (PF12146.7) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer