Transcript | Ll_transcript_88086 |
---|---|
CDS coordinates | 2-400 (+) |
Peptide sequence | LQVMSVDGNDGVVACKSACEAFGSPQYCCSGAYSTPDTCKPSSYSQVFKTACPRAYSYAYDDKTSTFTCENADYTITFCPVPNTSQKESQGQNTNQESSSNSTTSTLVDNGTMEYVGAADQSEISWATCAHVF |
ORF Type | internal |
Blastp | Thaumatin-like protein from Arabidopsis with 63.75% of identity |
---|---|
Blastx | Thaumatin-like protein from Arabidopsis with 63.75% of identity |
Eggnog | thaumatin-like protein(ENOG4111KEV) |
Kegg | Link to kegg annotations (AT1G18250) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436838.1) |
Pfam | Thaumatin family (PF00314.16) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer