Transcript | Ll_transcript_88101 |
---|---|
CDS coordinates | 160-492 (+) |
Peptide sequence | MASNRSQGGIQQLLAAEQEAQRIVNAAKNEKLARLKQAKEEAEKEIAEYRAQLEREFQKKVSDSSGDSGANVKRLEQETDEKIAQLKKDSARISDDVVSMLLKYVTTVKN* |
ORF Type | complete |
Blastp | V-type proton ATPase subunit G from Citrus with 74.55% of identity |
---|---|
Blastx | V-type proton ATPase subunit G1 from Arabidopsis with 75.45% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0001605) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431291.1) |
Pfam | Vacuolar (H+)-ATPase G subunit (PF03179.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer