Protein coding transcript 151

• Transcript: Ll_transcript_357239
• CDS coordinates: 3-308 (+)
• Peptide sequence: IKEGATFRMKARFRVQHEILSGMKYVQVVSRMGAKTKMQEMIGSYSPNTTDKPEYEKKFESETAPSGMLFRGHYEAVSVFTDDDKNEYLKFKWAFDIKKDW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_357239

• Blastp: Rho GDP-dissociation inhibitor from Schizosaccharomyces with 50.98% of identity
• Blastx: Rho GDP-dissociation inhibitor from Schizosaccharomyces with 50.98% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC6F12.06)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003594221.1)
• Pfam: RHO protein GDP dissociation inhibitor (PF02115.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;