Protein coding transcript 1510

• Transcript: Ll_transcript_425664
• CDS coordinates: 2-364 (+)
• Peptide sequence: KIIETKNEFDVIYIYYTFILTDPNSESRSGSVYIPRDEAFGHLKSSDFLIYGLKSVAQDVTSVLQSVFELDFTPNEFETFDEVRELYEGGIKLPTDAISKISPLPVLKEIFEPMASSSSSF
• ORF Type: internal

Annotations of Ll_transcript_425664

• Blastp: Seed linoleate 9S-lipoxygenase-3 from Soja with 78.02% of identity
• Blastx: Seed linoleate 9S-lipoxygenase-3 from Soja with 78.02% of identity
• Eggnog: Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding (By similarity)(ENOG410XT0Q)
• Kegg: Link to kegg annotations (547869)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443521.1)
• Pfam: Lipoxygenase (PF00305.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;