Transcript | Ll_transcript_426666 |
---|---|
CDS coordinates | 132-1070 (+) |
Peptide sequence | MSLISNCSPSYATVAGAGAGAAASNRRPKFPSNSWINTNAISQNDKFNVSRLALSHSNHRVKDRTISMALVGGALGQKGDVSTSSSTLAYDLIQGALVRWSSDMDRSLPAPPTAVFLHGILGCRKNWGTFARRLAQGFPTWQFLLVDMRCHGDSASIKKRGPHTVQSAALDVLKLVRELRITPRVLVGHSFGGKVALSMVDQAAKPLARPVKVWSLDATPGKVRAGGDGEDHPAELISFLRTLPKEVSSKRDVVKALIHQGFSNDVAQWVVTNLRSTSSTDSKLSSFTWVFDLMGIAEMYRSYEGTNLWYLL* |
ORF Type | complete |
Blastp | Protein ABHD11 from Xenopus with 26.83% of identity |
---|---|
Blastx | Protein ABHD11 from Xenopus with 28.36% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (735011) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444614.1) |
Pfam | Alpha/beta hydrolase family (PF12697.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer