Transcript | Ll_transcript_86855 |
---|---|
CDS coordinates | 764-1732 (+) |
Peptide sequence | MAPSSKAEKKAALDAAAWMFNVVTSVGIIIVNKALMATYGFSFATTLTGLHFATTTLMTTVLRMLGYVQASHLPLPDLLKFVLFANFSIVGMNVSLMWNSVGFYQIAKLTMIPVSCLLEVVLDKIHYSRDTKLSIGVVLLGVGVCTVTDVSVNTKGFVAAFIAVWSTSLQQYYVHLLQRKYSLSSFNLLGHTAPVQAASLLLLGPFLDYWLTDKRVDRYDYNTTALMFIIMSCTIAVGTNLSQFICIGRFTAVSFQVLGHMKTILVLIMGFFFFGKEGLNLHVVFGMIIAVAGMVWYGNASSKPGGKERRSHSLPTNRTETR* |
ORF Type | complete |
Blastp | UDP-rhamnose/UDP-galactose transporter 5 from Arabidopsis with 85% of identity |
---|---|
Blastx | UDP-rhamnose/UDP-galactose transporter 5 from Arabidopsis with 85% of identity |
Eggnog | solute carrier family 35 member(ENOG410XP1S) |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000055) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435029.1) |
Pfam | Triose-phosphate Transporter family (PF03151.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer