Protein coding transcript 151031

• Transcript: Ll_transcript_87612
• CDS coordinates: 256-924 (+)
• Peptide sequence: MEGNLNYTIEDNKKESRGALIVLEGLDRSGKSSQCSRLVSYLEGHGISAELWRFPDRTTDVGKMISAYLTNASQLDDHTIHLLFSANRWEKRSLMETKLTSGTTLIVDRYSYSGVAFSAAKGLDIEWCKAPEIGLLAADLVAYLDISPEKASERGGYGGERYEKLDFQKKVAESFKDLHDTAWKVVDACQPIEDVEKQLQDIVLHCVTECQKGKPLSFLWSK*
• ORF Type: complete

Annotations of Ll_transcript_87612

• Blastp: Thymidylate kinase from Arabidopsis with 73.66% of identity
• Blastx: Thymidylate kinase from Arabidopsis with 63.04% of identity
• Eggnog: Phosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis (By similarity)(COG0125)
• Kegg: Link to kegg annotations (AT5G59440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459500.1)
• Pfam: Thymidylate kinase (PF02223.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;