Transcript | Ll_transcript_87616 |
---|---|
CDS coordinates | 269-937 (+) |
Peptide sequence | MESSLNCSIEGNKKECRGALIVLEGLDRSGKSSQCSRLVSYLEGQGIHAELWRFPDRTTNVGQMISAYLTNASQLDDHTIHLLFSANRWEKRSLMETKLKTGTTLIVDRYSYSGVAFSAAKGLDIQWCKAPEIGLLAPDLVAYLDISPEKASERGGYGNERYEKLEFQKKVAESYKALHDVSWKVVDACQPIEDVEKKLQEIVVDCVTECQKGKPISTLWYQ* |
ORF Type | complete |
Blastp | Thymidylate kinase from Arabidopsis with 76.47% of identity |
---|---|
Blastx | Thymidylate kinase from Arabidopsis with 65.28% of identity |
Eggnog | Phosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis (By similarity)(COG0125) |
Kegg | Link to kegg annotations (AT5G59440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454851.1) |
Pfam | Thymidylate kinase (PF02223.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer