Protein coding transcript 151052

• Transcript: Ll_transcript_87804
• CDS coordinates: 124-528 (+)
• Peptide sequence: MVICQVPFLDVCNTLLDPSLPLTLLDYEEFGNPQIKSNFDSIFSCSPYDNVPPGSCFPSVLVTAAVNDSRVGVWEGAKWVAKVRDSTCSNCSRAVIMKTSMIGGHFGEGGHYGQCDETAYEYAFLMKAFGISKE*
• ORF Type: complete

Annotations of Ll_transcript_87804

• Blastp: Protease 2 from Moraxella with 40.3% of identity
• Blastx: Protease 2 from Escherichia with 44.8% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462190.1)
• Pfam: Prolyl oligopeptidase family (PF00326.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;