Protein coding transcript 1511

• Transcript: Ll_transcript_425655
• CDS coordinates: 80-532 (+)
• Peptide sequence: MQNLWFKGRGLGLIRDVCIPHPWRKSICLDDRSIEFISVYRWSGDERCKSDIGYAIAKNYWGQGITTKAVNIVVSQVFTEFHGLLRLQAFVDVKNFASQRVLEKVGFHKEGVLRSYTYSSGNVVFGTNHVTIYLPYGYFILCFMFYDMFH*
• ORF Type: complete

Annotations of Ll_transcript_425655

• Blastp: Uncharacterized N-acetyltransferase YoaA from Bacillus with 41.38% of identity
• Blastx: Putative ribosomal-protein-alanine acetyltransferase from Bacillus with 41.3% of identity
• Eggnog: NA(ENOG410XX2Y)
• Kegg: Link to kegg annotations (BSU18530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236452.1)
• Pfam: Acetyltransferase (GNAT) domain (PF13302.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;