Protein coding transcript 151296

• Transcript: Ll_transcript_87692
• CDS coordinates: 311-1066 (+)
• Peptide sequence: MAFSATSTTPSLNFTTFTSFPHNNFSSFSHSLSFPTSPFSNHNLSFSSHFTLPPTPRAHAPSTSTAPSSSTSSFHGLCYVVGDNIDTDQIIPAEYLTLVPSKPDEYEKLGSFALIGLPASYTARFVEPGESKTKYSVIIAGANFGCGSSREHAPVALGASGSAAVVAESYARIFFRNSVATGEVYPIESEARLCEECRTGDVVTIELEESRLINHTSGKEYRLKPIGDAGPVIEAGGIFAYARKTGMIPTR*
• ORF Type: complete

Annotations of Ll_transcript_87692

• Blastp: 3-isopropylmalate dehydratase small subunit 3 from Arabidopsis with 64.84% of identity
• Blastx: 3-isopropylmalate dehydratase small subunit 3 from Arabidopsis with 81.01% of identity
• Eggnog: Catalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate (By similarity)(COG0066)
• Kegg: Link to kegg annotations (AT2G43090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443388.1)
• Pfam: Aconitase C-terminal domain (PF00694.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;