Protein coding transcript 151313

• Transcript: Ll_transcript_86686
• CDS coordinates: 3-839 (+)
• Peptide sequence: RFVIQNTDMVFGTLGRYFSMRHQNSNKVQTLYDHCNNIFSSFQTQPPSSQALQKLVSILDTVQPADVGLVEESADDDRGHGFFGINQLSRVARWAQPITYVDIHESDSFTMCMFCFPTSSVIPLHDHPGMTVFSKLLYGSLHVKAYDWVEPPCIAESKGPGSAQGRLAKLSVDKVLTAPCETLVLYPKHGGNLHCFTAVTPCAVLDILSPPYREHEGRKCTYYHDYPYSAFSTRKGPGIETPKICDDEAEEYAWLAEIETPDDLYMRQGKYAGPVIQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_86686

• Blastp: Plant cysteine oxidase 3 from Arabidopsis with 62.26% of identity
• Blastx: Plant cysteine oxidase 3 from Arabidopsis with 61.89% of identity
• Eggnog: 2-aminoethanethiol(ENOG4111Y3H)
• Kegg: Link to kegg annotations (AT1G18490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417826.1)
• Pfam: PCO_ADO (PF07847.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;