Protein coding transcript 151318

• Transcript: Ll_transcript_88286
• CDS coordinates: 398-1075 (+)
• Peptide sequence: MAPYKYRGALNIGFQMSITIGILVANILNYFFAKIKGGWGWRLSLGGAMVPALIITIGSLVLPDTPNSMIERGDRDAAKAQLQKVRGVDDVDEEFNDLVAASEASMLVENPWRKLLQRKYRPHLTMAILIPFFQQFTGINVIMFYAPVLFSSIGFKDDASLMSAVITGVVNVVATTVSVYGVDKWGRRALFLEGGAQMLICQVPFFLTFNVIINWMNYSMKYLIW*
• ORF Type: complete

Annotations of Ll_transcript_88286

• Blastp: Sugar carrier protein C from Ricinus with 83.66% of identity
• Blastx: Sugar carrier protein C from Ricinus with 84.21% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (8275367)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434600.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;