Protein coding transcript 151326

• Transcript: Ll_transcript_88298
• CDS coordinates: 43-726 (+)
• Peptide sequence: MAPYRYRGALNIGFQMSITFGILIANILNYFFAKIKGGWGWRLSLGGAMVPALIITIGSLVLPDTPNSMIERGDRDAAKLQLQRVRGVDNVEEEFNDLVAASEASMLVEHPWRNLLQRKYRPQLTMAIMIPFFQQFTGINVIMFYAPVLFNSIGFKDDASLMSAVITGLVNVLATTVSIYGVDKWGRRALFLEGGTQMLICQAVIAAAIGAKFGIDGNPGDLPKWYAV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_88298

• Blastp: Sugar transport protein 1 from Arabidopsis with 81.14% of identity
• Blastx: Sugar carrier protein C from Ricinus with 83.06% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G11260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445620.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;