Protein coding transcript 151375

• Transcript: Ll_transcript_87776
• CDS coordinates: 232-906 (+)
• Peptide sequence: MGNKIARTTQVSASEYYLHELPSTYNLVLKEVLGRGRFFKSIQCKHDEGLVLVKVYFKRGDFIDLSEYERRLSLIKHIFQSIDHPHLWPFQFWQETDKAAYLLRQYFFHNLHDRLSTRPFLSFVEKKWLAFQLLLAVKQCHDKGVCHGDIKCENVLITSSNWLYLADFASFKPTYIPYDDPSDFSFFFDTGGRRLCYLAPEVNNFSFYIFLIYLYYLSYLVSLA*
• ORF Type: complete

Annotations of Ll_transcript_87776

• Blastp: Probable serine/threonine-protein kinase vps15 from Dictyostelium with 51.98% of identity
• Blastx: Probable serine/threonine-protein kinase vps15 from Dictyostelium with 51.98% of identity
• Eggnog: phosphoinositide-3-kinase, regulatory subunit 4(ENOG410XPDN)
• Kegg: Link to kegg annotations (DDB_G0282627)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458006.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;