Protein coding transcript 151377

• Transcript: Ll_transcript_87778
• CDS coordinates: 1059-1724 (+)
• Peptide sequence: MGSFSLYSFVTLAVLFLNLLVFCDGGKTSTFVRKDEKAIDLPLDSDVFAVPPGYNAPQQVHITQGDLVGKAVIVSWVTMDEPGSTVVRYWSDKHNHQKKTAEGKIVTYRFFNYTSGFIHHTTIKHLKYNTKYHYEIGFGNTTRRFWFITPPPVGPDVPYTFGLIGDLGQSFDSNRTLTHYEHNPRKGQAVLYVGDLSYADNYPNHDNVRWDTWGRFTERVVA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_87778

• Blastp: Purple acid phosphatase from Soja with 78.82% of identity
• Blastx: Purple acid phosphatase from Soja with 78.82% of identity
• Eggnog: Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454391.1)
• Pfam: Purple acid Phosphatase, N-terminal domain (PF16656.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;