Transcript | Ll_transcript_87779 |
---|---|
CDS coordinates | 1295-1810 (+) |
Peptide sequence | MYFIIIIVKVHITQGDLVGKAVIVSWVTMDEPGSTIVLYWSDKQSHQKKIAKGKIVTYRFFNYTSGFIHHTTIKHLKYNTKYHYEVGYGNTTRQFWFITPPPVGPDVPYTFGLIGDLGQTFDSNRTLTHYEHNPRKGQAVLYVGDLSYADNYPNHDNVRWDTWGRFTERVVA |
ORF Type | 3prime_partial |
Blastp | Purple acid phosphatase from Soja with 81.1% of identity |
---|---|
Blastx | Purple acid phosphatase from Soja with 81.1% of identity |
Eggnog | Hydrolyzes cAMP to 5'-AMP. Plays an important regulatory role in modulating the intracellular concentration of cAMP, thereby influencing cAMP-dependent processes (By similarity)(COG1409) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454391.1) |
Pfam | Purple acid Phosphatase, N-terminal domain (PF16656.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer