Protein coding transcript 15139

• Transcript: Ll_transcript_426709
• CDS coordinates: 421-762 (+)
• Peptide sequence: MDSQGQTTSLQRLQNVEKRIVKVLELAGGVMDELASPVGPRKELVQNHCLEFMQLIKDIQVALRDEIKSACEYRPFEKCDYGPRITNEICYNKVEYVISQLDAIKQTIHHYHA*
• ORF Type: complete

Annotations of Ll_transcript_426709

• Blastp: Mediator of RNA polymerase II transcription subunit 11 from Arabidopsis with 71.68% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 11 from Arabidopsis with 72.97% of identity
• Eggnog: mediator of RNA polymerase II transcription, subunit 11(ENOG4111TND)
• Kegg: Link to kegg annotations (AT3G01435)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418609.1)
• Pfam: Mediator complex protein (PF10280.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;