Protein coding transcript 151417

• Transcript: Ll_transcript_88751
• CDS coordinates: 586-1065 (+)
• Peptide sequence: MFLFCREVKNLGKLGGMGKEQIEVLNALDVAKTQWYHFTAIIIAGMGFFTDAYDLFCISLVTKLLGRIYYHHDGAEKPGSLPPNVAAAVNGVALVGTLSGQLFFGWLGDKLGRKKVYGMTLMLMVLCSIASGLSFGRDPKTVMTTLCFFRFWPGFGIGGD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_88751

• Blastp: Inorganic phosphate transporter 1-4 from Arabidopsis with 88.19% of identity
• Blastx: Probable inorganic phosphate transporter 1-7 from Arabidopsis with 88.89% of identity
• Eggnog: phosphate transporter(ENOG410ZVN7)
• Kegg: Link to kegg annotations (AT2G38940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459068.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;