| Transcript | Ll_transcript_88561 |
|---|---|
| CDS coordinates | 314-787 (+) |
| Peptide sequence | MASSLLLLPILLTALTLPLPLLVSADNGKWQLLQKSIGIVAMHMQLLHNDRVVIYDRTDFGFSNLSLPNGRCRHDDKELAVKTDCTAHSVEYDVASNRFRALFIQTNVWCSSGSVSPNGTLVQTGGFNDGERKVRTYSPCPTCDWQELENGLVARRW* |
| ORF Type | complete |
| Blastp | Aldehyde oxidase GLOX from Vitis with 44.78% of identity |
|---|---|
| Blastx | Aldehyde oxidase GLOX from Vitis with 44.78% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458830.1) |
| Pfam | Glyoxal oxidase N-terminus (PF07250.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer