Protein coding transcript 151472

• Transcript: Ll_transcript_88562
• CDS coordinates: 100-471 (+)
• Peptide sequence: MEAFSPSYLEPAFDNVRPRIVSPASQSQIMYGQMLELQFQVNGTLSRNLVLVTMLSPPFTTHSYSMNQRVLVLEPKSVTNVSETMYQVEVTTPGSPILAPPGFYLVFVVHQDIPSEGIWVHIH*
• ORF Type: complete

Annotations of Ll_transcript_88562

• Blastp: Aldehyde oxidase GLOX1 from Arabidopsis with 47.15% of identity
• Blastx: Aldehyde oxidase GLOX1 from Arabidopsis with 49.32% of identity
• Eggnog: Glyoxal oxidase(ENOG41110V0)
• Kegg: Link to kegg annotations (AT1G67290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457541.1)
• Pfam: Domain of unknown function (DUF1929) (PF09118.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;