Protein coding transcript 151475

• Transcript: Ll_transcript_88565
• CDS coordinates: 138-602 (+)
• Peptide sequence: METYVQKAQPFPQDLKVTIHKTSMIFPSKRTEKKSLFLSNIDKVLNFDVETVHFFVANNDFPPKIVAEKFKKALEDALVVYDFLAGRLKVNTETNRLEIDCNAEGAGFVEASSEYKLNQIGDLVYPNPAFGQFVHKNKHFLKPGDVPLCVFQVQ*
• ORF Type: complete

Annotations of Ll_transcript_88565

• Blastp: Rosmarinate synthase from Solenostemon with 37.06% of identity
• Blastx: Aldehyde oxidase GLOX1 from Arabidopsis with 48.98% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457541.1)
• Pfam: Transferase family (PF02458.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;