Transcript | Ll_transcript_88569 |
---|---|
CDS coordinates | 2069-2827 (+) |
Peptide sequence | MISLYFCSRYSTNNKLPDGGQIIIGGRRQFNYEFYPKTEATAKNTYSLPFLVQTNEPRIENNLYPFVFLNVDGNLFIFANNRAILFNYTNNVVVKTFPQIPGGDPRSYPSSGSAVLLPLRNLHGAVLEAEVLVCGGAPKGSFEQASKGHFIGALNTCARVKVTDPNPNWVMETMPDGRVMSDMVMLPDGNVLIVNGAGSGTAGWRFGRNPALNPIIYKTYSPLGSRFELQNPSSIPRMYHSTAVLVRDGRVS* |
ORF Type | complete |
Blastp | Aldehyde oxidase GLOX1 from Arabidopsis with 48.98% of identity |
---|---|
Blastx | Aldehyde oxidase GLOX1 from Arabidopsis with 48.98% of identity |
Eggnog | Glyoxal oxidase(ENOG41110V0) |
Kegg | Link to kegg annotations (AT1G67290) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457541.1) |
Pfam | Glyoxal oxidase N-terminus (PF07250.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer