Protein coding transcript 151489

• Transcript: Ll_transcript_88582
• CDS coordinates: 73-663 (+)
• Peptide sequence: MSWTCSCVLVLIFVLPFLPFLASPASPIKNLPGYDGVLPFNLQAGYIGVGEGEEVQIFHLFVESQRNPNIDPLLLWFVGGPGCSALSAFFFENGPLRMDRNYGGDIPKLELNPYGWTQRLNMIYVDMPVGTGFSYSKTQQGYYSNDTQWVEHAYSFLQKWFIDHPKFGSNPLYIGGGSYSGLVTGPLVQKVYEGKY*
• ORF Type: complete

Annotations of Ll_transcript_88582

• Blastp: Serine carboxypeptidase-like 1 from Arabidopsis with 53.18% of identity
• Blastx: Serine carboxypeptidase-like 1 from Arabidopsis with 52.54% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT5G36180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454247.1)
• Pfam: Serine carboxypeptidase (PF00450.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;