Protein coding transcript 151515

• Transcript: Ll_transcript_87008
• CDS coordinates: 315-656 (+)
• Peptide sequence: MQEGAIKLSEQQKAADSLKGYSKGEIMEFRKQMQQTYDDQLKRITEMVESKLKEATTRLERQLAEEQTARLKAEEKAKLAQLKSDDEIRKLRQHLEMAHEELRKRGENRCAIL*
• ORF Type: complete

Annotations of Ll_transcript_87008

• Blastp: Immune-associated nucleotide-binding protein 9 from Arabidopsis with 56.44% of identity
• Blastx: Immune-associated nucleotide-binding protein 9 from Arabidopsis with 56.44% of identity
• Eggnog: gTPase, IMAP family member(ENOG4111GYZ)
• Kegg: Link to kegg annotations (AT1G33970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461220.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;