Protein coding transcript 151516

• Transcript: Ll_transcript_87012
• CDS coordinates: 143-1147 (+)
• Peptide sequence: MMGGSSIDDDWLLASSTKTVVLVGRTGNGKSATGNSILGKKAFSSRLSSSGVTSTCELQKTVLSDGQHVNVIDTPGLFDFSAGSDFVGKEIVKCIDLAKDGIHAVLVVFSVRTRFTQEEEAALRSLQTLFGDKIVNYMIVVFTGGDALEDDGETLDDYLGRECPEPLQEILALCDNRRVLFDNKTKDGKKKFEQVQQLLSLVDMVISQNGGRPYVDELFTELKEGAIKLSEQQKAADSLKGYSKGEIMEFRKQMQQTYDDQLKRITEMVESKLKEATTRLERQLAEEQTARLKAEEKAKLAQLKSDDEIRKLRQHLEMAHEELRKRGENRCAIL*
• ORF Type: complete

Annotations of Ll_transcript_87012

• Blastp: Immune-associated nucleotide-binding protein 9 from Arabidopsis with 61.77% of identity
• Blastx: Immune-associated nucleotide-binding protein 9 from Arabidopsis with 61.77% of identity
• Eggnog: gTPase, IMAP family member(ENOG4111GYZ)
• Kegg: Link to kegg annotations (AT1G33970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461220.1)
• Pfam: AIG1 family (PF04548.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;