Protein coding transcript 151517

• Transcript: Ll_transcript_87014
• CDS coordinates: 618-1532 (+)
• Peptide sequence: MMGGSSIDDDWLLASSTKTVVLVGRTGNGKSATGNSILGKKAFSSRLSSSGVTSTCELQKTVLSDGQHVNVIDTPGLFDFSAGSDFVGKEIVKCIDLAKDGIHAVLVVFSVRTRFTQEEEAALRSLQTLFGDKIVNYMIVVFTGGDALEDDGETLDDYLGRECPEPLQEILALCDNRRVLFDNKTKDGKKKFEQVQQLLSLVDMVISQNGGRPYTNKIFTYLKENTINMRDQQRMEEMVKEFTQKLNEAITRLEQQLEEERNARCKAEENAKFAQQKSDDEIRELKEHLKKAEEYRGQSGCVIL*
• ORF Type: complete

Annotations of Ll_transcript_87014

• Blastp: Immune-associated nucleotide-binding protein 9 from Arabidopsis with 53.56% of identity
• Blastx: Immune-associated nucleotide-binding protein 9 from Arabidopsis with 53.73% of identity
• Eggnog: gTPase, IMAP family member(ENOG4111GYZ)
• Kegg: Link to kegg annotations (AT1G33970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461220.1)
• Pfam: AIG1 family (PF04548.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;