Protein coding transcript 151652

• Transcript: Ll_transcript_87879
• CDS coordinates: 644-1489 (+)
• Peptide sequence: MIHTLQVTGRRDRAKPLTFKMDSRGPWGFAGANDGNPKISAKFIAPCYSMNKIEIDTKLPIVGDQKWVIWICSFNIPMAPGKTRSIVCSARNFFQFTVPGPAWWQVVPRWYEHWTSNKVYDGDMIVLQGQEKIFLTATKEGGDINKQYTNITFTPTQADRFVLAFRNWLRRHGNSQPEWFGTVDQQQLPSTVLSKRQMMDRFEQHTLKCSSCKRAYEAFQTWQKILIGATVLFCATSGIPSDIQLRVILAALALATAGLAFALNQLQNNFVFIDYVHADID*
• ORF Type: complete

Annotations of Ll_transcript_87879

• Blastp: Pheophorbide a oxygenase, chloroplastic from Arabidopsis with 74.19% of identity
• Blastx: Pheophorbide a oxygenase, chloroplastic from Arabidopsis with 72.66% of identity
• Eggnog: rieske 2fe-2S domain-containing protein(COG4638)
• Kegg: Link to kegg annotations (AT3G44880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413798.1)
• Pfam: Pheophorbide a oxygenase (PF08417.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;