Protein coding transcript 15172

• Transcript: Ll_transcript_426321
• CDS coordinates: 112-681 (+)
• Peptide sequence: MARTLVLSLLVVLMASQIVFGVDHIVGGSGGWALGNDYSTWASGETFTVGDNLVFNYDSTHQVDQVDASSYKSCSASNSIKNYNDGNSKVPLTTSGTLYFICPTSGHCAGGMKLQVNVVAATSTTTPSGGSPPTTPSSGTTPTPSTPSQSGTPPATPSTKANGAISVSSGISHLIVSMFVAAIVFGFMG*
• ORF Type: complete

Annotations of Ll_transcript_426321

• Blastp: Uclacyanin 1 from Arabidopsis with 42.42% of identity
• Blastx: Uclacyanin 1 from Arabidopsis with 49.51% of identity
• Eggnog: Early nodulin-like protein(ENOG410YT2D)
• Kegg: Link to kegg annotations (AT2G32300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463954.1)
• Pfam: Plastocyanin-like domain (PF02298.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;