Transcript | Ll_transcript_86791 |
---|---|
CDS coordinates | 317-1015 (+) |
Peptide sequence | MIKILNVDILCYSSLFDLKVLLSFYLHNSITVIFFAKEGEGCILTPMKEDSLPPVTANFQQGLGQKFKQPAGTGIDFSIFEESELLKVTDMDVYPLAVKADASSHDGDGSNETPTSGSTNLQITQAVFEKEKGEFLVKVVKQILWVNGMRYELQEIYGIGSSVESDLDGNDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVGPEPEE* |
ORF Type | complete |
Blastp | Probable E3 ubiquitin-protein ligase LOG2 from Arabidopsis with 68.66% of identity |
---|---|
Blastx | Probable E3 ubiquitin-protein ligase LOG2 from Arabidopsis with 68.66% of identity |
Eggnog | RING finger(ENOG410XRAE) |
Kegg | Link to kegg annotations (AT3G09770) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432624.1) |
Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer