Protein coding transcript 151781

• Transcript: Ll_transcript_86820
• CDS coordinates: 190-858 (+)
• Peptide sequence: MVMENQKASLVLSSPRTSNNINNGLALSSPRTSKNISNGFTIPQPIIRSDSTNPYPTTFVQADTSSFKQVVQMLTGSSETAKQVSSSSSPSTTRTGNLIHHNIPYPQINKNQTGFKLYERRKSLNHLKINPLNPVYSPRKSEILSPSVLDLPSLILSPVTPLMPDPFDPTRLISEAEEKAIKEKGFFLHPSPRPPTPRDAEPRLLPLFPTTSPTASGFSSVL*
• ORF Type: complete

Annotations of Ll_transcript_86820

• Blastp: VQ motif-containing protein 4 from Arabidopsis with 57.5% of identity
• Blastx: VQ motif-containing protein 4 from Arabidopsis with 56% of identity
• Eggnog: VQ motif-containing protein(ENOG410YVV0)
• Kegg: Link to kegg annotations (AT1G28280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418257.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;