Protein coding transcript 1519

• Transcript: Ll_transcript_534133
• CDS coordinates: 133-930 (+)
• Peptide sequence: MKLLIDNGADISDANPGHVACTAAAQNNLELLKEVVQCGIDVTQPNKNGTTALHAAVCEGNTEMVQFLLDQGANIDKIDGNGWTPRDLADQQGHEEIQNIFNNGNENRKPPVTPPSLSNNDNKSFMRFHSEPGMSLLSKANMQHKQDLKLETQERLIRSRSFHNSIFGMISAANRSKGARMAAENSNTSTRDMHEVVAPRVILSCPEKGAHVGKLVFLPKSLQELLDIGAKKFDFSPTKVLTKEGAEIDDINLIRDGDHLIVAQD*
• ORF Type: complete

Annotations of Ll_transcript_534133

• Blastp: Potassium channel AKT1 from Oryza sativa with 47.42% of identity
• Blastx: Potassium channel AKT1 from Oryza sativa with 47.42% of identity
• Eggnog: Potassium voltage-gated channel, subfamily H (Eag-related), member(ENOG410XPSE)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416698.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;