Protein coding transcript 151919

• Transcript: Ll_transcript_88483
• CDS coordinates: 207-1433 (+)
• Peptide sequence: MKTHIDLNSPQQSKKGSKHLKGSFWSAPSVFTNKLHKWMQKHKMKKHHNETISTTFPVENPISDYCLRKRSCDTDPRFSLDIGRMSFENDPMYSFDEPRASLDGYLIGRTMVPRMHTMLSLVEDAPMHVLRTDTQIPVTNFGDNDDVDDDDNVPGGSAQTREYYDLSFRRRKSIDRSNSIKKTAAAVVNEMVELKCGSIVNTNANVNASKFGGFVDCDLRPNSLRGDCCSEKQTTELGFKDTSSVIRNGNWKGSNSKKSRRWSKAWSIWGFINRRGGNKDQDEDEDNYIKPNKGARHSFSESWQDLRGDHNGKGAFDGRLFRSNSSISHRNAPNLGGSFGIVRSNENVKKAKDEFVLERNKSGRYSPKSIDNGLLQLYLTPTRGSQRNGSVKNSNHANSVPRNLPPLY*
• ORF Type: complete

Annotations of Ll_transcript_88483

• Blastp: UPF0503 protein At3g09070, chloroplastic from Arabidopsis with 39.96% of identity
• Blastx: UPF0503 protein At3g09070, chloroplastic from Arabidopsis with 38.87% of identity
• Eggnog: UPF0503 protein At3g09070(ENOG410YBGZ)
• Kegg: Link to kegg annotations (AT3G09070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465037.1)
• Pfam: Protein of unknown function (DUF740) (PF05340.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;