Protein coding transcript 151968

• Transcript: Ll_transcript_86861
• CDS coordinates: 175-711 (+)
• Peptide sequence: MDYNNTQNIGATDPWDLLKMDYCVQKTSNFEIPEELWNDGLQTEEDISYMFENVTTPVKACGDLAYTISNGDNMQKELEEYRETSQVKRRRMLQFNSQDSDHSFSSEEATSAYLKLNEKEDSKKDIFPEVSQWMCGAAGNATASGYEDLESTEGWLAECFNDAEMQFSPDDLYASLDQ*
• ORF Type: complete

Annotations of Ll_transcript_86861

• Blastp: Protein XRI1 from Arabidopsis with 40.99% of identity
• Blastx: Protein XRI1 from Arabidopsis with 58.33% of identity
• Eggnog: NA(ENOG410YGP1)
• Kegg: Link to kegg annotations (AT5G48720)
• CantataDB: Link to cantataDB annotations (CNT0001513)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020213901.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;