Protein coding transcript 151970

• Transcript: Ll_transcript_86870
• CDS coordinates: 175-555 (+)
• Peptide sequence: MDYNNTQNIGATDPWDLLKMDYCVQKTSNFEIPEELWNDGLQTEEDISYMFENVTTPVKACGDLAYTISNGDNMQKELEEYRETSQVKRRRMLQFNSQDSDHSFSSEEATSAYLKLNVSVCSFSHS*
• ORF Type: complete

Annotations of Ll_transcript_86870

• Blastp: Protein XRI1 from Arabidopsis with 39.32% of identity
• Blastx: Protein XRI1 from Arabidopsis with 39.32% of identity
• Eggnog: NA(ENOG410YGP1)
• Kegg: Link to kegg annotations (AT5G48720)
• CantataDB: Link to cantataDB annotations (CNT0001513)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449101.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;