Protein coding transcript 1520

• Transcript: Ll_transcript_534077
• CDS coordinates: 142-849 (+)
• Peptide sequence: MASYENLSPIDSWAFRPTLPDSWLADYIARDAQVLTKALQKSISGNHDVSFSPPFNPLNHDVNVPAPTSSTVSGLSGGSDHESAPKRRSVGATGKISKRKSRASKRSQTTFITADPADFRQMVQQVTGVKVAGSEMREMAPVVKPEPQRLNGGSAGRMRLPVGTGYLPTLDTSAFLLDHHQQQGPGPNSRTTGFSGPGPLIFGPPIGMIDSSFGISDIDFDTFSSFPTLESWKMR*
• ORF Type: complete

Annotations of Ll_transcript_534077

• Blastp: Calmodulin-binding protein 25 from Arabidopsis with 40.49% of identity
• Blastx: Calmodulin-binding protein 25 from Arabidopsis with 41.54% of identity
• Eggnog: VQ motif-containing protein(ENOG410YN0G)
• Kegg: Link to kegg annotations (AT2G41010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458991.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;