Protein coding transcript 152026

• Transcript: Ll_transcript_88446
• CDS coordinates: 180-770 (+)
• Peptide sequence: MAVCLDGTLPGYHLDRGFGSGANSWLVHLEGGGWCNTIRNCVYRKTSRHGSSNYMESEIPFTGILSNKAEENPDFFNWNRVKLRYCDGASFSGDSQDESAQLQFRGQKIWLAAIEELMSKGMQNAEQALLSGCSAGGLASIIHCDEFRNSFPESTKVKCLSDAGFFLDATDVSGGRTLRNLFEGVVQLQVVFNVVL*
• ORF Type: complete

Annotations of Ll_transcript_88446

• Blastp: Pectin acetylesterase 12 from Arabidopsis with 77.6% of identity
• Blastx: Pectin acetylesterase 6 from Arabidopsis with 78.14% of identity
• Eggnog: pectinacetylesterase(ENOG410XQKD)
• Kegg: Link to kegg annotations (AT3G05910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427884.1)
• Pfam: Pectinacetylesterase (PF03283.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;