Protein coding transcript 152028

• Transcript: Ll_transcript_88455
• CDS coordinates: 378-1100 (+)
• Peptide sequence: MTNMTTMKLVLVAVGFACLLSGVISFGSDTLSMLSFLENGAVSVSSTKPSSLPQPVMVGLTLIEGAASTGAVCLDGTLPGYHLDRGFGSGANSWLVHLEGGGWCNTIRNCVYRKTSRHGSSNYMESEIPFTGILSNKAEENPDFFNWNRVKLRYCDGASFSGDSQDESAQLQFRGQKIWLAAIEELMSKGMQNAEQALLSGCSAGGLASIIHCDEFRNSFPESTKVKCLSDAGFFFFFFV*
• ORF Type: complete

Annotations of Ll_transcript_88455

• Blastp: Pectin acetylesterase 6 from Arabidopsis with 65.11% of identity
• Blastx: Pectin acetylesterase 6 from Arabidopsis with 65.52% of identity
• Eggnog: pectinacetylesterase(ENOG410XQKD)
• Kegg: Link to kegg annotations (AT3G62060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427884.1)
• Pfam: Pectinacetylesterase (PF03283.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;