Protein coding transcript 152180

• Transcript: Ll_transcript_252521
• CDS coordinates: 1545-2066 (+)
• Peptide sequence: MNMGRGRKNLKRASEEEHVTLQDGQTIMQVLSLRGSNLIEVMDAHGEKSLALFPAKFQKSMWMKRGSFVVVDESAKEKALESGCKVACIVSQVLFFEQVRELKKSPEWPEIFKSGIGDSNERTTSQQEKKMVKSDDDDSDSDGLPPLEANTNRIRPVELQADDDSESGSDTDT*
• ORF Type: complete

Annotations of Ll_transcript_252521

• Blastp: Probable RNA-binding protein EIF1AD from Bos with 36.72% of identity
• Blastx: Probable RNA-binding protein EIF1AD from Bos with 36.72% of identity
• Eggnog: eukaryotic translation initiation factor 1A domain containing(ENOG4111N6Z)
• Kegg: Link to kegg annotations (615726)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414213.1)
• Pfam: Translation initiation factor 1A / IF-1 (PF01176.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;