Transcript | Ll_transcript_252849 |
---|---|
CDS coordinates | 360-797 (+) |
Peptide sequence | MVNVDHNNSSSTNSSGESREGKKKRLTQFFEGMMREVIENQERLQKKLMEVLEKCENERKAREEAWKVEELARIKREREILAQERAISAAKDEAVLVLLKKFTENAGTVVHLPETIKVTNEKENNNNMQENDNNGGSVMDKDKDKD |
ORF Type | 3prime_partial |
Blastp | Trihelix transcription factor GT-2 from Arabidopsis with 45.12% of identity |
---|---|
Blastx | Trihelix transcription factor PTL from Arabidopsis with 33.03% of identity |
Eggnog | chromatin binding(ENOG410YBXG) |
Kegg | Link to kegg annotations (AT1G76890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430907.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer