Protein coding transcript 15241

• Transcript: Ll_transcript_426447
• CDS coordinates: 4035-4586 (+)
• Peptide sequence: MIESAYKISADDKMKSRSARPAGDQDNKTTVRTKPDSKTDTKVSDSEVGMPEEMSFSQKDINVKQSKSQTTNNVNPNIDTNNIVSSSLTSTDDGGLPTIMSTKQQGEKKPASQSHASNRPVLEENIVLGVALDGSKRTLPIDEGIDNAATTREAKEMAACQGGNGSPKGTDGNDKIAIAPTSK*
• ORF Type: complete

Annotations of Ll_transcript_426447

• Blastp: Mechanosensitive ion channel protein 2, chloroplastic from Arabidopsis with 38.76% of identity
• Blastx: Mechanosensitive ion channel protein 2, chloroplastic from Arabidopsis with 90.76% of identity
• Eggnog: Mechanosensitive ion channel(COG0668)
• Kegg: Link to kegg annotations (AT5G10490)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421403.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;