Protein coding transcript 152503

• Transcript: Ll_transcript_252480
• CDS coordinates: 698-1780 (+)
• Peptide sequence: MITTCFLTRKEVASSRSHDRVELTEDVLGNPNSAVALVDYASESDEDTPSECQETHNQNSGHTKKFDGIKSRNEQRFPVSGEPVCLICGRYGEYICNETDDDVCSMECKRELLEILKLDEGCTHNQVRDFSSGVSDASPVPVFGDDTWDYNRHRWSKKISSLSTYECWKCHRPGHIAEDCIVNSCSEITVPSNRSSSIPKDLLGLYRRCHEFGKDLLAANCNTCHSSSNLATCLDCSIVFCDSAGHLNEHIRAYPSHQKYYSHKLKRLVKCCKSTCKVTDIKDLLVCHYCFDKAFEKFYDMYTATWKGAGLSIIWGSICCEDHFTWHRMNCLNAGVEESAYIVKNSGHKSKRTQLSDFIF*
• ORF Type: complete

Annotations of Ll_transcript_252480

• Blastp: DEAD-box ATP-dependent RNA helicase 41 from Arabidopsis with 64.58% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 41 from Arabidopsis with 63.27% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (AT3G02065)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434392.1)
• Pfam: HIT zinc finger (PF04438.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;