Protein coding transcript 152513

• Transcript: Ll_transcript_252479
• CDS coordinates: 269-1246 (+)
• Peptide sequence: MGTRTNFYKNPSISYNKHFSLSSVLQNLQAYNVATGNVLPDDQPQPDLTTASDHKTPSLKRRRPPQSRAGDDDGNDAPFSMSHRDYIEKRRKEVASSRSHDRVELTEDVLGNPNSAVALVDYASESDEDTPSECQETHNQNSGHTKKFDGIKSRNEQRFPVSGEPVCLICGRYGEYICNETDDDVCSMECKRELLEILKLDEGCTHNQVRDFSSGVSDASPVPVFGDDTWDYNRHRWSKKISSLSTYECWKCHRPGHIAEDCIVNSCSEITVPSNRSSSIPKDLLGLYRRCHEFGKDLLAANCNTCHSSSNLATCLDCSIVFCDR*
• ORF Type: complete

Annotations of Ll_transcript_252479

• Blastp: Probable ATP-dependent RNA helicase DDX59 from Rattus with 63.83% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 41 from Arabidopsis with 64.58% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (289402)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434392.1)
• Pfam: HIT zinc finger (PF04438.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;