Protein coding transcript 152531

• Transcript: Ll_transcript_253433
• CDS coordinates: 589-1254 (+)
• Peptide sequence: MVLHSKLMSLGRGVCEQVPEFPSKLFFYCEVEPGSGGETPIVLSHVVYERMKEKYPEFVERLEKYGLLYIRVLGEDDNPSSPIGRGWKSTFLTTDKSVAEQRAEKLGMKLEWLDDGVKTIMGPIPAVKYDEKRHRKIWFNSMVAAYTGWKDEKNDPVKAVTFGDGQPLPADIVYDCLRILEEECVAIPWQKGDVLLLDNWAVLHSRRSFDPPRRVLASLVK*
• ORF Type: complete

Annotations of Ll_transcript_253433

• Blastp: Clavaminate synthase-like protein At3g21360 from Arabidopsis with 82.52% of identity
• Blastx: Clavaminate synthase-like protein At3g21360 from Arabidopsis with 82.52% of identity
• Eggnog: taurine catabolism dioxygenase taud tfda(ENOG410XPT7)
• Kegg: Link to kegg annotations (AT3G21360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436463.1)
• Pfam: Taurine catabolism dioxygenase TauD, TfdA family (PF02668.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;